Recombinant Full Length Human SFPQ Protein, C-Flag-tagged
Cat.No. : | SFPQ-789HFL |
Product Overview : | Recombinant Full Length Human SFPQ Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables DNA binding activity; histone deacetylase binding activity; and protein homodimerization activity. Involved in several processes, including alternative mRNA splicing, via spliceosome; positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway; and regulation of transcription by RNA polymerase II. Acts upstream of or within double-strand break repair via homologous recombination. Located in chromatin; nuclear matrix; and paraspeckles. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 76.1 kDa |
AA Sequence : | MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQQ QPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSAPPASSSAPPATPPTSG APPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQAGGPPPPPAAVPGPGPGPKQGPGPGGPKGG KMPGGPKPGGGPGLSTPGGHPKPPHRGGGEPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKA NLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKA ELDDTPMRGRQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFAS KPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEY SQRWKSLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLMRRQEELRRMEELHNQEMQKR KEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQK FPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEG PNKKPRFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | SFPQ splicing factor proline and glutamine rich [ Homo sapiens (human) ] |
Official Symbol | SFPQ |
Synonyms | PSF; POMP100; PPP1R140 |
Gene ID | 6421 |
mRNA Refseq | NM_005066.3 |
Protein Refseq | NP_005057.1 |
MIM | 605199 |
UniProt ID | P23246 |
◆ Recombinant Proteins | ||
SFPQ-856H | Recombinant Human SFPQ protein, GST-tagged | +Inquiry |
SFPQ-789HFL | Recombinant Full Length Human SFPQ Protein, C-Flag-tagged | +Inquiry |
SFPQ-30711TH | Recombinant Human SFPQ, His-tagged | +Inquiry |
SFPQ-12471Z | Recombinant Zebrafish SFPQ | +Inquiry |
Sfpq-5814M | Recombinant Mouse Sfpq Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFPQ-1911HCL | Recombinant Human SFPQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFPQ Products
Required fields are marked with *
My Review for All SFPQ Products
Required fields are marked with *
0
Inquiry Basket