Recombinant Human SFPQ protein, GST-tagged

• Cat.No.: SFPQ-856H
• Product Overview: Recombinant Human SFPQ(269 a.a. - 361 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 269-361 a.a.
• Description: Splicing factor, proline- and glutamine-rich is a protein that in humans is encoded by the SFPQ gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.97 kDa
• AA Sequence: EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRA LAEIAKAELDDTPMRGRQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SFPQ splicing factor proline/glutamine-rich [ Homo sapiens ]
• Official Symbol: SFPQ
• Synonyms: SFPQ; splicing factor proline/glutamine-rich; splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated); splicing factor, proline- and glutamine-rich; polypyrimidine tract binding protein associated; PSF; hPOMp100; 100 kDa DNA-pairing protein; PTB-associated splicing factor; PTB-associated-splicing factor; DNA-binding p52/p100 complex, 100 kDa subunit; polypyrimidine tract-binding protein-associated splicing factor; polypyrimidine tract-binding protein-associated-splicing factor; splicing factor proline/glutamine rich (polypyrimidine tract-binding protein-associated); POMP100; DKFZp547C228; DKFZp667K0521; DKFZp686K1282
• Gene ID: 6421
• mRNA Refseq: NM_005066
• Protein Refseq: NP_005057
• MIM: 605199
• UniProt ID: P23246
• Chromosome Location: 1p34.3
• Pathway: mRNA processing, organism-specific biosystem
• Function: DNA binding; RNA binding; nucleotide binding; protein binding