Recombinant Full Length Human RPTOR Protein

• Cat.No.: RPTOR-448HF
• Product Overview: Recombinant full length Human Raptor with proprietary tag; Predicted MWt 67.76 kDa.

Specification

• Description: This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 67.760kDa inclusive of tags
• Protein length: 379 amino acids
• AA Sequence: MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: RPTOR regulatory associated protein of MTOR, complex 1 [ Homo sapiens ]
• Official Symbol: RPTOR
• Synonyms: RPTOR; regulatory associated protein of MTOR, complex 1; regulatory-associated protein of mTOR; KIAA1303; KOG1; Mip1; raptor; regulatory associated protein of Mtor
• Gene ID: 57521
• mRNA Refseq: NM_001163034
• Protein Refseq: NP_001156506
• MIM: 607130
• UniProt ID: Q8N122