Recombinant Full Length Human RFC2 Protein, C-Flag-tagged
Cat.No. : | RFC2-1904HFL |
Product Overview : | Recombinant Full Length Human RFC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the activator 1 small subunits family. The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). Replication factor C, also called activator 1, is a protein complex consisting of five distinct subunits. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP and may help promote cell survival. Disruption of this gene is associated with Williams syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene of this gene has been defined on chromosome 2. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39 kDa |
AA Sequence : | MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVP NIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIIL DEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKER VPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYK ILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMA PVAS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | DNA replication, Mismatch repair, Nucleotide excision repair |
Full Length : | Full L. |
Gene Name | RFC2 replication factor C subunit 2 [ Homo sapiens (human) ] |
Official Symbol | RFC2 |
Synonyms | RFC40 |
Gene ID | 5982 |
mRNA Refseq | NM_181471.3 |
Protein Refseq | NP_852136.1 |
MIM | 600404 |
UniProt ID | P35250 |
◆ Recombinant Proteins | ||
RFC2-1703H | Recombinant Human RFC2 protein, His & T7-tagged | +Inquiry |
RFC2-4663R | Recombinant Rat RFC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFC2-3673R | Recombinant Rhesus Macaque RFC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFC2-1884H | Recombinant Human RFC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFC2-1904HFL | Recombinant Full Length Human RFC2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFC2-2412HCL | Recombinant Human RFC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RFC2 Products
Required fields are marked with *
My Review for All RFC2 Products
Required fields are marked with *
0
Inquiry Basket