Recombinant Full Length Human RBX1 protein, GST-tagged

• Cat.No.: RBX1-3416H
• Product Overview: Recombinant Human RBX1 protein(P62877)(1-108aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-108aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.3 kDa
• AA Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RBX1 ring-box 1, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: RBX1
• Synonyms: RBX1; ring-box 1, E3 ubiquitin protein ligase; ring box 1; E3 ubiquitin-protein ligase RBX1; BA554C12.1; regulator of cullins 1; RNF75; ROC1; ZYP protein; RING box protein 1; RING-box protein 1; RING finger protein 75; MGC1481; FLJ60363; MGC13357
• Gene ID: 9978
• mRNA Refseq: NM_014248
• Protein Refseq: NP_055063
• MIM: 603814
• UniProt ID: P62877