Recombinant Human RBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RBX1-969H
• Product Overview: RBX1 MS Standard C13 and N15-labeled recombinant protein (NP_055063) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.
• Molecular Mass: 12.3 kDa
• AA Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RBX1 ring-box 1 [ Homo sapiens (human) ]
• Official Symbol: RBX1
• Synonyms: RBX1; ring-box 1, E3 ubiquitin protein ligase; ring box 1; E3 ubiquitin-protein ligase RBX1; BA554C12.1; regulator of cullins 1; RNF75; ROC1; ZYP protein; RING box protein 1; RING-box protein 1; RING finger protein 75; MGC1481; FLJ60363; MGC13357
• Gene ID: 9978
• mRNA Refseq: NM_014248
• Protein Refseq: NP_055063
• MIM: 603814
• UniProt ID: P62877