Recombinant Full Length Human RAPGEF4-AS1 Protein, GST-tagged

• Cat.No.: RAPGEF4-AS1-5937HF
• Product Overview: Human LOC91149 full-length ORF ( ACE87342.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 114 amino acids
• Description: RAPGEF4-AS1 (RAPGEF4 Antisense RNA 1) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Molecular Mass: 38.94 kDa
• AA Sequence: MRGQLLLRGMKEELYLLYILSFIYKDIREHLRMFQGHQKLSENAFLQRRFPEIEDNSGSLEEVNLGRQDSFSPPVALQEAIPSPLGKVDPPSPDEKSSLCLLFPLPDDPEALQL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RAPGEF4-AS1 RAPGEF4 antisense RNA 1 [ Homo sapiens (human) ]
• Official Symbol: RAPGEF4-AS1
• Synonyms: RAPGEF4-AS1; RAPGEF4 antisense RNA 1; RAPGEF4 antisense RNA 1 (non-protein coding)
• Gene ID: 91149