Active Recombinant Rat Il5 Protein

• Cat.No.: Il5-238I
• Product Overview: Recombinant Rat Il5 Protein without tag was expressed in CHO.

Specification

• Species: Rat
• Source: CHO
• Description: Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, mediates the activities of eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 ng/mL, measured in a proliferation assay using TF-1 Cells.
• Molecular Mass: 13~21 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Rat Interleukin-5 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Interleukin-5 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il5 interleukin 5 [ Rattus norvegicus ]
• Official Symbol: Il5
• Synonyms: IL5; interleukin 5; interleukin-5; TRF; IL-5; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Interleukin 5 (colony-stimulating factor eosinophil); Interleukin 5 (colony-stimulating factor, eosinophil)
• Gene ID: 24497
• mRNA Refseq: NM_021834
• Protein Refseq: NP_068606
• UniProt ID: Q9R2C9