Recombinant Pseudomonas aeruginosa PA1870 Protein

• Cat.No.: PA1870-125P
• Product Overview: Recombinant Pseudomonas aeruginosa PA1870 Protein was expressed in E. coli.

Specification

• Species: Pseudomonas aeruginosa
• Source: E.coli
• Description: hypothetical protein
• Form: Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl.
• Molecular Mass: ~ 15.5 kDa
• AA Sequence: ATRRKTTPQEIDDIQDRMGSMRELDFDERRQARKARIGDERPEAEVEAEFSSRRVREAGHAGGQPDEDDGYQDNVGMDDLAPETLIDESGARSPAERGGESPADKRLRVVHGNEIGAGHGLDEAELARRDPLDGSSDEER
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.1 mg/ml

Gene Information

• Gene Name: PA1870 hypothetical protein [ Pseudomonas aeruginosa PAO1 ]
• Official Symbol: PA1870
• Gene ID: 877596
• Protein Refseq: NP_250561
• UniProt ID: Q9I2M6