Recombinant Full Length Human RAG2 Protein
Cat.No. : | RAG2-425HF |
Product Overview : | Recombinant full length Human RAG2 with N terminal proprietary tag; Predicted MWt 84.04 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 527 amino acids |
Description : | This gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4. Mutations in this gene cause Omenn syndrome, a form of severe combined immunodeficiency associated with autoimmune-like symptoms. |
Form : | Liquid |
Molecular Mass : | 84.04 kDa inclusive of tags |
AA Sequence : | MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRS CPTGVFHLDVKHNHVKLKPTIFSKDSCYLPPLRYPATCTF KGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKV TFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGALFGGRS YMPSTHRTTEKWNSVADCLPCVFLVDFEFGCATSYILPEL QDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDL PLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLE NQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGS NTGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQT TFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFD TYNEDDEEDESETGYWITCCPTCDVDINTWVPFYSTELNK PAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNE HVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKS FLRRLFD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | RAG2 recombination activating gene 2 [ Homo sapiens ] |
Official Symbol | RAG2 |
Synonyms | RAG2; recombination activating gene 2; V(D)J recombination-activating protein 2 |
Gene ID | 5897 |
mRNA Refseq | NM_000536 |
Protein Refseq | NP_000527 |
MIM | 179616 |
UniProt ID | P55895 |
◆ Native Proteins | ||
Mb-160M | Native Mouse Mb | +Inquiry |
TOD-43 | Active Native Tyramine Oxidase | +Inquiry |
SNCB-27206TH | Native Human SNCB | +Inquiry |
Lectin-1812P | Active Native Peanut Lectin Protein, Agarose Bound | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf142-138HCL | Recombinant Human C9orf142 lysate | +Inquiry |
TFPI2-1519MCL | Recombinant Mouse TFPI2 cell lysate | +Inquiry |
SW1353-179H | SW1353 Whole Cell Lysate | +Inquiry |
IGHM-843HCL | Recombinant Human IGHM cell lysate | +Inquiry |
NUCKS1-445HCL | Recombinant Human NUCKS1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RAG2 Products
Required fields are marked with *
My Review for All RAG2 Products
Required fields are marked with *
0
Inquiry Basket