Recombinant Full Length Human QDPR Protein, His-tagged

• Cat.No.: QDPR-679H
• Product Overview: Recombinant Human QDPR fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Description: The product of this enzyme, tetrahydrobiopterin (BH-4), is an essential cofactor for phenylalanine, tyrosine, and tryptophan hydroxylases.
• Source: HEK293 cells
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM Tris-HCl, pH8.0
• Molecular Mass: 26.8kD
• AA Sequence: MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYFVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: QDPR quinoid dihydropteridine reductase [ Homo sapiens ]
• Official Symbol: QDPR
• Synonyms: QDPR; quinoid dihydropteridine reductase; dihydropteridine reductase; 6; 7 dihydropteridine reductase; DHPR; PKU2; SDR33C1; short chain dehydrogenase/reductase family 33C; member 1; HDHPR; 6,7-dihydropteridine reductase; short chain dehydrogenase/reductase family 33C, member 1; FLJ42391
• Gene ID: 5860
• mRNA Refseq: NM_000320
• Protein Refseq: NP_000311
• MIM: 612676
• UniProt ID: P09417