Recombinant Full Length Human Putative Vomeronasal Receptor-Like Protein 4(Vn1R17P) Protein, His-Tagged
Cat.No. : | RFL29480HF |
Product Overview : | Recombinant Full Length Human Putative vomeronasal receptor-like protein 4(VN1R17P) Protein (Q8TDU5) (1-208aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-208) |
Form : | Lyophilized powder |
AA Sequence : | MEMTKLFSYIVIKNVYYPQVSFGISANTFLLLFHIFTFAYTHRLKPIDMTISHLPLIHIL LLFTQAILVSSDLFESWNIQNNDLKCKIITFLNRVMRGVSICTTCLLSVLQAITISPSTS FLEKFKHISANHTLGFILFSWVLNMFITNNLLLFIVPTPNRIGASLLFVTEHCYVLPMSY THRSLFFILMVLRDVIFIGLMVLSSGYG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VN1R17P |
Synonyms | VN1R17P; VNRL4; Putative vomeronasal receptor-like protein 4; G-protein coupled receptor GPCR23; hGPCR23 |
UniProt ID | Q8TDU5 |
◆ Native Proteins | ||
293T-01NE | Native HEK293 Nuclear Extract | +Inquiry |
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
GG-183H | Native Human Gamma Globulin | +Inquiry |
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP4-4503HCL | Recombinant Human MAP4 293 Cell Lysate | +Inquiry |
F13A1-6485HCL | Recombinant Human F13A1 293 Cell Lysate | +Inquiry |
REL-2424HCL | Recombinant Human REL 293 Cell Lysate | +Inquiry |
IL21R-1442RCL | Recombinant Rat IL21R cell lysate | +Inquiry |
CENPK-7582HCL | Recombinant Human CENPK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All VN1R17P Products
Required fields are marked with *
My Review for All VN1R17P Products
Required fields are marked with *
0
Inquiry Basket