Recombinant Full Length Human Putative Olfactory Receptor 51H1(Or51H1P) Protein, His-Tagged
Cat.No. : | RFL15723HF |
Product Overview : | Recombinant Full Length Human Putative olfactory receptor 51H1(OR51H1P) Protein (Q8NH63) (1-302aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-302) |
Form : | Lyophilized powder |
AA Sequence : | MTNLNASQANHRNFILTGIPGTPDKNPWLAFPLGFLYTLTLLGNGTILAVIKVEPSLHEP TYYFLSILALTDVSLSMSTLPSMLSIYWFNAPQIVFDACIMQMFFIHVFGIVESGVLVSM AFDRFVAIRNPLHYVSILTHDVIRKTGIAVLTRAVCVVFPVPFLIKCLPFCHSNVLSHSY CLHQNMMRLACASTRINSLYGLIVVIFTLGLDVLLTLLSYVLTLKTVLGIVSRGERLKTL STCLSHMSTVLLFYVPFMGAASMIHRFWEHLSPVVHMVMADIYLLLPPVLNPIVYSVKTK QI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR51H1 |
Synonyms | OR51H1; OR51H1P; Olfactory receptor 51H1; Olfactory receptor OR11-25 |
UniProt ID | Q8NH63 |
◆ Recombinant Proteins | ||
NR1H2-1354H | Recombinant Human NR1H2, His-tagged | +Inquiry |
TRMT61B-2263H | Recombinant Human TRMT61B Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF2B5-2703M | Recombinant Mouse EIF2B5 Protein, His (Fc)-Avi-tagged | +Inquiry |
AMBP-882HFL | Recombinant Full Length Human AMBP Protein, C-Flag-tagged | +Inquiry |
CDK12-16H | Recombinant Human CDK12 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
Lectin-1812P | Active Native Peanut Lectin Protein, Agarose Bound | +Inquiry |
Fixa-279B | Active Native Bovine Factor IXa - EGR | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3A-1326RCL | Recombinant Rat REG3A cell lysate | +Inquiry |
PDCD2-3362HCL | Recombinant Human PDCD2 293 Cell Lysate | +Inquiry |
ARMC10-8702HCL | Recombinant Human ARMC10 293 Cell Lysate | +Inquiry |
GART-687HCL | Recombinant Human GART cell lysate | +Inquiry |
GSTM5-760HCL | Recombinant Human GSTM5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR51H1 Products
Required fields are marked with *
My Review for All OR51H1 Products
Required fields are marked with *
0
Inquiry Basket