Recombinant Full Length Human Putative Olfactory Receptor 10Ac1(Or10Ac1P) Protein, His-Tagged
Cat.No. : | RFL29771HF |
Product Overview : | Recombinant Full Length Human Putative olfactory receptor 10AC1(OR10AC1P) Protein (Q8NH08) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-325) |
Form : | Lyophilized powder |
AA Sequence : | MDSPSNATVPCGFLLQGFSEFPHLRPVLFLLLLGVHLATLGGNLLILVAVASMPSRQPML LFLCQLSAIELCYTLVVVPRSLVDLSTPGHRRGSPISFLSCAFQMQMFVALGGAECFLLA AMAYDRYVAICHPLRYAAVVTPGLCARLALACCLRGLAVSVGLTVAIFHLPFCGSRLLLH FFCDITALLHLACTRSYADELPLLGACLVLLLLPSVLILASYGAIAAALRRLRCPKGRGK AASTCALHLAVTFLHYGCATFMYVRPRASYSPRLDRTLALVYTNVTPLLCPLIYSLRNRE ITAALSRVLGRRRPGQAPGGDLREL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR10AC1 |
Synonyms | OR10AC1; OR10AC1P; Olfactory receptor 10AC1; Olfactory receptor OR7-5 |
UniProt ID | Q8NH08 |
◆ Recombinant Proteins | ||
Ncr3-1158R | Active Recombinant Rat Ncr3 protein, His-tagged | +Inquiry |
PEDINA-P26-4392S | Recombinant Staphylococcus aureus (strain: E-1) PEDINA_P26 protein, His-tagged | +Inquiry |
RFL20994SF | Recombinant Full Length Saccharomyces Cerevisiae Protein Hph2(Frt2) Protein, His-Tagged | +Inquiry |
TPH1-17252M | Recombinant Mouse TPH1 Protein | +Inquiry |
NRM-4082R | Recombinant Rat NRM Protein | +Inquiry |
◆ Native Proteins | ||
IgM-331S | Native Sheep IgM | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
PROS1-31218TH | Native Human PROS1 Protein | +Inquiry |
Immunoglobulin A2-78H | Native Human Immunoglobulin A2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC22C-1995HCL | Recombinant Human SEC22C 293 Cell Lysate | +Inquiry |
SLC25A4-1762HCL | Recombinant Human SLC25A4 293 Cell Lysate | +Inquiry |
WAS-734HCL | Recombinant Human WAS lysate | +Inquiry |
PTPLA-2689HCL | Recombinant Human PTPLA 293 Cell Lysate | +Inquiry |
CXCR3-7162HCL | Recombinant Human CXCR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR10AC1 Products
Required fields are marked with *
My Review for All OR10AC1 Products
Required fields are marked with *
0
Inquiry Basket