Recombinant Full Length Saccharomyces Cerevisiae Protein Hph2(Frt2) Protein, His-Tagged
Cat.No. : | RFL20994SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein HPH2(FRT2) Protein (P39734) (1-528aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-528) |
Form : | Lyophilized powder |
AA Sequence : | MQNAQIKSSSKGSGIDGTDRNSKDGVEKRPLEDVKQMIDAGTPDVGHKSTVETKPNVGWQ ASHSNLAALHEKEQKYEMEHHHARHKLHRQVIPDYTSASTAMFSDCMFNAAPDKVRSLST MKSSGLSPKHPFNVVATFKGPFPQHSVESKPLDGGYSAKDHFPSFKMLQAQQHPAHRHYK DNDKYGLKSPSRSFVKDKKRLVHRFLKSMEPSSSGQSKDSSALAPAFDPILPNVISKPSK RPTHHSHSSDGSSSTQTDISLQSLLYHDLESSPKKHVSPSRPPSVASESSPAVANPIGLS PKDACNASFSQSSSSSLSSSSSSSSSTSFSQSVAVDPLEPPGNITYSSSNLSLNSDELDY YQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVE EDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRKMES LLSLENSLMISKKNVTFASKYRNEALDIVFLIIIIVICYTFKHLVSHK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FRT2 |
Synonyms | FRT2; HPH2; YAL028W; Protein HPH2; Functionally related to TCP1 protein 2; High pH protein 2 |
UniProt ID | P39734 |
◆ Native Proteins | ||
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
PLG-55H | Native Human lys-Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRPAP1-2574HCL | Recombinant Human LRPAP1 cell lysate | +Inquiry |
UGGT2-1878HCL | Recombinant Human UGGT2 cell lysate | +Inquiry |
PLB1-1369HCL | Recombinant Human PLB1 cell lysate | +Inquiry |
HHLA3-5567HCL | Recombinant Human HHLA3 293 Cell Lysate | +Inquiry |
SERPINB3C-658MCL | Recombinant Mouse SERPINB3C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FRT2 Products
Required fields are marked with *
My Review for All FRT2 Products
Required fields are marked with *
0
Inquiry Basket