Recombinant Full Length Human Protein Odr-4 Homolog(Odr4) Protein, His-Tagged
Cat.No. : | RFL26086HF |
Product Overview : | Recombinant Full Length Human Protein odr-4 homolog(ODR4) Protein (Q5SWX8) (1-454aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-454) |
Form : | Lyophilized powder |
AA Sequence : | MGRTYIVEETVGQYLSNINLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHP KAKLDNLDEEWATEHACQVSRMLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSIN RKRLWNFTEEEVSERVTLHICASTKKIFCRTYDIHDPKSSARPADWKYQSGLSSSWLSLE CTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKDEDCDLLEGQKKS SRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLKGAVKCRAYIHSSKPKVKD AVQAVKRDILNTVADRCEMLFEDLLLNEIPEKKDSEKEFHVLPYRVFVPLPGSTVMLCDY KFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPI KTTMLLKIQQNIGVIAAFTVAVLAAGISFHYFSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ODR4 |
Synonyms | ODR4; C1orf27; TTG1; TTG1A; Protein odr-4 homolog; hODR-4; LAG1-interacting protein; Transactivated by transforming growth factor beta protein 1 |
UniProt ID | Q5SWX8 |
◆ Recombinant Proteins | ||
NAMPT-134H | Recombinant Human Nicotinamide Phosphoribosyltransferase | +Inquiry |
ACOT13-2034HFL | Recombinant Full Length Human ACOT13 Protein, C-Flag-tagged | +Inquiry |
PHOSPHO2-3413R | Recombinant Rhesus monkey PHOSPHO2 Protein, His-tagged | +Inquiry |
CALU-2661M | Recombinant Mouse CALU Protein | +Inquiry |
CTSS-1329R | Recombinant Rat CTSS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
IgG-329R | Native Rabbit Gamma Globulin Fraction | +Inquiry |
SOD1-101B | Active Native Bovine SOD | +Inquiry |
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNIP-620HCL | Recombinant Human TXNIP 293 Cell Lysate | +Inquiry |
MEPCE-4364HCL | Recombinant Human MEPCE 293 Cell Lysate | +Inquiry |
RCC1-2445HCL | Recombinant Human RCC1 293 Cell Lysate | +Inquiry |
MBIP-4443HCL | Recombinant Human MBIP 293 Cell Lysate | +Inquiry |
KCND3-5068HCL | Recombinant Human KCND3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ODR4 Products
Required fields are marked with *
My Review for All ODR4 Products
Required fields are marked with *
0
Inquiry Basket