Recombinant Full Length Human Prostaglandin E2 Receptor Ep3 Subtype(Ptger3) Protein, His-Tagged
Cat.No. : | RFL35150HF |
Product Overview : | Recombinant Full Length Human Prostaglandin E2 receptor EP3 subtype(PTGER3) Protein (P43115) (1-390aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-390) |
Form : | Lyophilized powder |
AA Sequence : | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI RYHTNNYASSSTSLPCQCSSTLMWSDHLER |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTGER3 |
Synonyms | PTGER3; Prostaglandin E2 receptor EP3 subtype; PGE receptor EP3 subtype; PGE2 receptor EP3 subtype; PGE2-R; Prostanoid EP3 receptor |
UniProt ID | P43115 |
◆ Recombinant Proteins | ||
UBE2V1-2298H | Recombinant Human UBE2V1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FABP5-269H | Recombinant Human FABP5 protein, His-tagged | +Inquiry |
Gas6-196M | Recombinant Mouse Gas6 Protein, His/GST-tagged | +Inquiry |
ALDH1B1-1403HF | Recombinant Full Length Human ALDH1B1 Protein, GST-tagged | +Inquiry |
BCRC-0367B | Recombinant Bacillus subtilis BCRC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSS-27405TH | Native Human CTSS | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
KLK3-8247H | Native Human Prostate Specific Antigen | +Inquiry |
GFP-36B | Native Bovine GFP | +Inquiry |
DDIM-6H | Native Human D-dimer protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL4D-8711HCL | Recombinant Human ARL4D 293 Cell Lysate | +Inquiry |
LGMN-2893MCL | Recombinant Mouse LGMN cell lysate | +Inquiry |
Colon ascending-78C | Cynomolgus monkey Colon ascending Lysate | +Inquiry |
MAVS-1909HCL | Recombinant Human MAVS cell lysate | +Inquiry |
DNM1L-6858HCL | Recombinant Human DNM1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PTGER3 Products
Required fields are marked with *
My Review for All PTGER3 Products
Required fields are marked with *
0
Inquiry Basket