Recombinant Full Length Rabbit Prostaglandin E2 Receptor Ep3 Subtype(Ptger3) Protein, His-Tagged
Cat.No. : | RFL21017OF |
Product Overview : | Recombinant Full Length Rabbit Prostaglandin E2 receptor EP3 subtype(PTGER3) Protein (P46069) (1-411aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus (Rabbit) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-411) |
Form : | Lyophilized powder |
AA Sequence : | MKETRGDGGSAPFCTRLNHSYPGMWAPEARGNLTRPPGPGEDCGSVSVAFPITMLITGFV GNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSKQRWEQLD PSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLA VLAFALLPVLGVGQYTIQWPGTWCFISTGRGDNGTSSSHNWGNLFFASTFAFLGLLALAI TFTCNLATIKALVSRCRAKAAASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLK MIFNQTSVEHCKTDTGKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQVIHEN NEQKDEIQRENRNVSHSGQHEEARDSEKSKTIPGLFSILLQADPGARPYQQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTGER3 |
Synonyms | PTGER3; Prostaglandin E2 receptor EP3 subtype; PGE receptor EP3 subtype; PGE2 receptor EP3 subtype; Prostanoid EP3 receptor |
UniProt ID | P46069 |
◆ Native Proteins | ||
LDH2-19H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
Lectin-1763A | Active Native Agaricus bisporus lectin Protein, Agarose bound | +Inquiry |
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
Collagen-60H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCO-2563MCL | Recombinant Mouse MARCO cell lysate | +Inquiry |
NXPH4-1241HCL | Recombinant Human NXPH4 cell lysate | +Inquiry |
CYP2D6-7112HCL | Recombinant Human CYP2D6 293 Cell Lysate | +Inquiry |
ZNF74-2083HCL | Recombinant Human ZNF74 cell lysate | +Inquiry |
MMS19-1124HCL | Recombinant Human MMS19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGER3 Products
Required fields are marked with *
My Review for All PTGER3 Products
Required fields are marked with *
0
Inquiry Basket