Recombinant Full Length Human PPP2CB Protein

Cat.No. : PPP2CB-410HF
Product Overview : Recombinant full length Human PPP2CB withan N terminal proprietary tag; Predicted MWt 59.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 309 amino acids
Description : This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit.
Form : Liquid
Molecular Mass : 59.730kDa inclusive of tags
AA Sequence : MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILT KESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNY LFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVD GQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLW SDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name PPP2CB protein phosphatase 2, catalytic subunit, beta isozyme [ Homo sapiens ]
Official Symbol PPP2CB
Synonyms PPP2CB; protein phosphatase 2, catalytic subunit, beta isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform; serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; PP2Abeta; protein phosphatase 2A catalytic subuni
Gene ID 5516
mRNA Refseq NM_001009552
Protein Refseq NP_001009552
MIM 176916
UniProt ID P62714

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP2CB Products

Required fields are marked with *

My Review for All PPP2CB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon