Recombinant Full Length Human PPP2CB Protein
Cat.No. : | PPP2CB-410HF |
Product Overview : | Recombinant full length Human PPP2CB withan N terminal proprietary tag; Predicted MWt 59.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 309 amino acids |
Description : | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit. |
Form : | Liquid |
Molecular Mass : | 59.730kDa inclusive of tags |
AA Sequence : | MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILT KESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNY LFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVD GQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLW SDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PPP2CB protein phosphatase 2, catalytic subunit, beta isozyme [ Homo sapiens ] |
Official Symbol | PPP2CB |
Synonyms | PPP2CB; protein phosphatase 2, catalytic subunit, beta isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform; serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; PP2Abeta; protein phosphatase 2A catalytic subuni |
Gene ID | 5516 |
mRNA Refseq | NM_001009552 |
Protein Refseq | NP_001009552 |
MIM | 176916 |
UniProt ID | P62714 |
◆ Recombinant Proteins | ||
PPP2CB-4291R | Recombinant Rat PPP2CB Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2CB-2620H | Recombinant Human PPP2CB Protein, His-tagged | +Inquiry |
PPP2CB-4632R | Recombinant Rat PPP2CB Protein | +Inquiry |
PPP2CB-27931TH | Recombinant Human PPP2CB | +Inquiry |
PPP2CB-6681C | Recombinant Chicken PPP2CB | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2CB-2927HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
PPP2CB-2928HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP2CB Products
Required fields are marked with *
My Review for All PPP2CB Products
Required fields are marked with *
0
Inquiry Basket