Recombinant Full Length Human PPP1R17 Protein, GST-tagged

• Cat.No.: PPP1R17-3433HF
• Product Overview: Human C7orf16 full-length ORF (NP_006649.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 155 amino acids
• Description: The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]
• Molecular Mass: 44.3 kDa
• AA Sequence: MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PPP1R17 protein phosphatase 1, regulatory subunit 17 [ Homo sapiens ]
• Official Symbol: PPP1R17
• Synonyms: PPP1R17; protein phosphatase 1, regulatory subunit 17; C7orf16, chromosome 7 open reading frame 16; protein phosphatase 1 regulatory subunit 17; G substrate; GSBS; G-substrate; C7orf16
• Gene ID: 10842
• mRNA Refseq: NM_001145123
• Protein Refseq: NP_001138595
• MIM: 604088
• UniProt ID: O96001