Recombinant Human PPP1R17 Protein, GST-Tagged

Cat.No. : PPP1R17-0134H
Product Overview : Human C7orf16 full-length ORF (NP_006649.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]
Molecular Mass : 44.3 kDa
AA Sequence : MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PPP1R17 protein phosphatase 1, regulatory subunit 17 [ Homo sapiens ]
Official Symbol PPP1R17
Synonyms PPP1R17; protein phosphatase 1, regulatory subunit 17; C7orf16, chromosome 7 open reading frame 16; protein phosphatase 1 regulatory subunit 17; G substrate; GSBS; G-substrate; C7orf16;
Gene ID 10842
mRNA Refseq NM_001145123
Protein Refseq NP_001138595
MIM 604088
UniProt ID O96001

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP1R17 Products

Required fields are marked with *

My Review for All PPP1R17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon