Recombinant Full Length Human Potassium Voltage-Gated Channel Subfamily S Member 1(Kcns1) Protein, His-Tagged
Cat.No. : | RFL2068HF |
Product Overview : | Recombinant Full Length Human Potassium voltage-gated channel subfamily S member 1(KCNS1) Protein (Q96KK3) (1-526aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-526) |
Form : | Lyophilized powder |
AA Sequence : | MLMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR RQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRT GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQ EFEDLLSSIDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNS1 |
Synonyms | KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1; Voltage-gated potassium channel subunit Kv9.1 |
UniProt ID | Q96KK3 |
◆ Native Proteins | ||
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKOV3-057WCY | Human Ovarian Carcinoma SKOV3 Whole Cell Lysate | +Inquiry |
TRIM9-762HCL | Recombinant Human TRIM9 293 Cell Lysate | +Inquiry |
ISCA1-5155HCL | Recombinant Human ISCA1 293 Cell Lysate | +Inquiry |
HA-004H5N1CL | Recombinant H5N1 HA cell lysate | +Inquiry |
PARL-3431HCL | Recombinant Human PARL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KCNS1 Products
Required fields are marked with *
My Review for All KCNS1 Products
Required fields are marked with *
0
Inquiry Basket