Recombinant Full Length Human Potassium Voltage-Gated Channel Subfamily A Member 10(Kcna10) Protein, His-Tagged
Cat.No. : | RFL2429HF |
Product Overview : | Recombinant Full Length Human Potassium voltage-gated channel subfamily A member 10(KCNA10) Protein (Q16322) (1-511aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-511) |
Form : | Lyophilized powder |
AA Sequence : | MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHE TAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQ FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR EDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARAVAVVSVLVVVISITIFCLETLPE FREDRELKVVRDPNLNMSKTVLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFF RNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEI ERILNSVGSRMGSTDSLNKTNGGCSTEKSRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNA10 |
Synonyms | KCNA10; Potassium voltage-gated channel subfamily A member 10; Voltage-gated potassium channel subunit Kv1.8 |
UniProt ID | Q16322 |
◆ Recombinant Proteins | ||
Tnfrsf14-01M | Recombinant Mouse tumor necrosis factor receptor superfamily member 14 protein, His&Fc tagged | +Inquiry |
YTQB-2205B | Recombinant Bacillus subtilis YTQB protein, His-tagged | +Inquiry |
STK31-8807M | Recombinant Mouse STK31 Protein, His (Fc)-Avi-tagged | +Inquiry |
NARFL-4941C | Recombinant Chicken NARFL | +Inquiry |
GK5-4871Z | Recombinant Zebrafish GK5 | +Inquiry |
◆ Native Proteins | ||
IgG-018R | Native Rabbit Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
IgG-329R | Native Rabbit Gamma Globulin Fraction | +Inquiry |
E2-01H | Native Human Estradiol (E2) | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
CVB1-12 | Native Coxsackievirus B1 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIX2-1824HCL | Recombinant Human SIX2 293 Cell Lysate | +Inquiry |
FGF18-2430MCL | Recombinant Mouse FGF18 cell lysate | +Inquiry |
PLEKHA4-1373HCL | Recombinant Human PLEKHA4 cell lysate | +Inquiry |
NFYB-3839HCL | Recombinant Human NFYB 293 Cell Lysate | +Inquiry |
SGPL1-1595HCL | Recombinant Human SGPL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNA10 Products
Required fields are marked with *
My Review for All KCNA10 Products
Required fields are marked with *
0
Inquiry Basket