Recombinant Full Length Human PLEK Protein
Cat.No. : | PLEK-373HF |
Product Overview : | Recombinant full length Human Pleckstrin (amino acids 1-350) with a N terminal proprietary tag: predicted MW 67.10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 350 amino acids |
Description : | Pleckstrin is a protein found in platelets. The name derives from platelet and leukocyte C kinase substrate and the KSTR string of amino acids. |
Form : | Liquid |
Molecular Mass : | 67.100kDa inclusive of tags |
AA Sequence : | MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKS DNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHF FQAAFLEERDAWVRDINKAIKCIEGGQKFARKSTRRSIRL PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC VIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSA VDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEE FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDP AGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITA DEVHYFLQAATPKERTEWIKAIQMASRTGK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PLEK pleckstrin [ Homo sapiens ] |
Official Symbol | PLEK |
Synonyms | PLEK; pleckstrin; P47 |
Gene ID | 5341 |
mRNA Refseq | NM_002664 |
Protein Refseq | NP_002655 |
MIM | 173570 |
UniProt ID | P08567 |
◆ Recombinant Proteins | ||
MAVS-7052H | Recombinant Human MAVS protein, His-SUMO-tagged | +Inquiry |
HGF-872H | Recombinant Human HGF, None tagged | +Inquiry |
H3.1C-314H | Recombinant Human H3.1 Core Histone Protein | +Inquiry |
SOX18-1480HFL | Recombinant Full Length Human SOX18 Protein, C-Flag-tagged | +Inquiry |
RFL8802EF | Recombinant Full Length Alpha-Hemolysin Translocation Atp-Binding Protein Hlyb(Hlyb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Complement C3d-48H | Native Human Complement C3d | +Inquiry |
ApoA4-68H | Native Human Apolipoprotein AIV | +Inquiry |
LDH2-8340H | Native Human LDH2 | +Inquiry |
HBA2-27787TH | Native Human HBA2 | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Balb-150M | 3T3 Balb Whole Cell Lysate | +Inquiry |
ILF2-5222HCL | Recombinant Human ILF2 293 Cell Lysate | +Inquiry |
SERPINA6-1910MCL | Recombinant Mouse SERPINA6 cell lysate | +Inquiry |
RPS6KA3-2161HCL | Recombinant Human RPS6KA3 293 Cell Lysate | +Inquiry |
TRIM54-768HCL | Recombinant Human TRIM54 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLEK Products
Required fields are marked with *
My Review for All PLEK Products
Required fields are marked with *
0
Inquiry Basket