Recombinant Full Length Human PLA2G12A Protein, C-Flag-tagged
Cat.No. : | PLA2G12A-207HFL |
Product Overview : | Recombinant Full Length Human PLA2G12A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDG SKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQ KTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Full Length : | Full L. |
Gene Name | PLA2G12A phospholipase A2 group XIIA [ Homo sapiens (human) ] |
Official Symbol | PLA2G12A |
Synonyms | GXII; ROSSY; PLA2G12 |
Gene ID | 81579 |
mRNA Refseq | NM_030821.5 |
Protein Refseq | NP_110448.2 |
MIM | 611652 |
UniProt ID | Q9BZM1 |
◆ Recombinant Proteins | ||
PLA2G12A-1709H | Recombinant Human PLA2G12A Protein (23-185 aa), His-tagged | +Inquiry |
Pla2g12a-8261M | Recombinant Mouse Pla2g12a protein, His & T7-tagged | +Inquiry |
PLA2G12A-12883M | Recombinant Mouse PLA2G12A Protein | +Inquiry |
PLA2G12A-1692H | Recombinant Human PLA2G12A Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G12A-30734TH | Recombinant Human PLA2G12A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G12A-482HCL | Recombinant Human PLA2G12A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G12A Products
Required fields are marked with *
My Review for All PLA2G12A Products
Required fields are marked with *
0
Inquiry Basket