Recombinant Human PLA2G12A protein, His&Myc-tagged

• Cat.No.: PLA2G12A-2337H
• Product Overview: Recombinant Human PLA2G12A protein(Q9BZM1)(23-189aa) was fused to N-terminal His tag and C-terminal Myc tag.

Specification

• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 22.6 kDa
• Protein length: 23-189aa
• AA Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: PLA2G12A phospholipase A2, group XIIA [ Homo sapiens ]
• Official Symbol: PLA2G12A
• Synonyms: PLA2G12A; phospholipase A2, group XIIA; phospholipase A2, group XII , PLA2G12; group XIIA secretory phospholipase A2; sPLA2-XII; GXII sPLA2; group XII secreted phospholipase A2; group XIIA secreted phospholipase A2; phosphatidylcholine 2-acylhydrolase 12A; GXII; ROSSY; PLA2G12
• Gene ID: 81579
• mRNA Refseq: NM_030821
• Protein Refseq: NP_110448
• MIM: 611652
• UniProt ID: Q9BZM1