Recombinant Human PLA2G12A Protein (23-185 aa), His-tagged

• Cat.No.: PLA2G12A-1709H
• Product Overview: Recombinant Human PLA2G12A Protein (23-185 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.

Specification

• Description: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.
• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 20.3 kDa
• Protein length: 23-185 aa
• AA Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: PLA2G12A phospholipase A2, group XIIA [ Homo sapiens ]
• Official Symbol: PLA2G12A
• Synonyms: PLA2G12A; sPLA2-XII; GXII sPLA2; GXII; ROSSY; PLA2G12
• Gene ID: 81579
• mRNA Refseq: NM_030821
• Protein Refseq: NP_110448
• MIM: 611652
• UniProt ID: Q9BZM1