Recombinant Full Length Human PKP2 Protein, C-Myc/DDK-tagged
Cat.No. : | PKP2-670HFL |
Product Overview : | Recombinant Full Length Protein of Human PKP2, transcript variant 2a, fused to Myc/DDK-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Myc&DDK |
Description : | This gene encodes a member of the arm-repeat (armadillo) and plakophilin gene families. Plakophilin proteins contain numerous armadillo repeats, localize to cell desmosomes and nuclei, and participate in linking cadherins to intermediate filaments in the cytoskeleton. This gene may regulate the signaling activity of beta-catenin and is required to maintain transcription of genes that control intracellular calcium cycling including ryanodine receptor 2, ankyrin-B, triadin, and calcium channel, voltage-dependent, L type, alpha 1C. Mutations in this gene are associated with different inherited cardiac conditions including Arrythmogenic Cardiomyopathy, Brugada Syndrome, and Idiopathic Ventricular Fibrillation. A processed pseudogene with high similarity to this gene has been mapped to chromosome 12p13. |
Form : | 100 mM Glycine, pH 3.5, 10% Glycerol. |
Molecular Mass : | 92.7 kDa |
AA Sequence : | MAAPGAPAEYGYIRTVLGQQILGQLDSSSLALPSEAKLKLAGSSGRGGQTVKSLRIQEQVQQTLARKGRS SVGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERS LRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRYARSEIVGVSRAGTTSR QRHFDTYHRQYQHGSVSDTVFDSIPANPALLTYPRPGTSRSMGNLLEKENYLTAGLTVGQVRPLVPLQPV TQNRASRSSWHQSSFHSTRTLREAGPSVAVDSSGRRAHLTVGQAAAGGSGNLLTERSTFTDSQLGNADME MTLERAVSMLEADHMPPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVCGALR NLVFEDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITGLLWNLSSNDKLKNLMITEALLTLTENIIIP FSGWPEGDYPKANGLLDFDIFYNVTGCLRNMSSAGADGRKAMRRCDGLIDSLVHYVRGTIADYQPDDKAT ENCVCILHNLSYQLEAELPEKYSQNIYIQNRNIQTDNNKSIGCFGSRSRKVKEQYQDVPMPEEKSNPKGV EWLWHSIVIRMYLSLIAKSVRNYTQEASLGALQNLTAGSGPMPTSVAQTVVQKESGLQHTRKMLHVGDPS VKKTAISLLRNLSRNLSLQNEIAKETLPDLVSIIPDTVPSTDLLIETTASACYTLNNIIQNSYQNARDLL NTGGIQKIMAISAGDAYASNKASKAASVLLYSLWAHTELHHAYKKAQFKKTDFVNSRTAKAYHSLKD myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade after receiving vials. |
Concentration : | >50 µg/µL as determined by microplate BCA method. |
Protein Pathways : | Arrhythmogenic right ventricular cardiomyopathy (ARVC) |
Full Length : | Full L. |
Gene Name | PKP2 plakophilin 2 [ Homo sapiens (human) ] |
Official Symbol | PKP2 |
Synonyms | ARVD9 |
Gene ID | 5318 |
mRNA Refseq | NM_004572.4 |
Protein Refseq | NP_004563.2 |
MIM | 602861 |
UniProt ID | Q99959 |
◆ Native Proteins | ||
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
Immunoglobulin G2-82H | Native Human Immunoglobulin G2 | +Inquiry |
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
PR-01H | Native HIV1 PR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C4orf27-118HCL | Recombinant Human C4orf27 lysate | +Inquiry |
SKAP2-1816HCL | Recombinant Human SKAP2 293 Cell Lysate | +Inquiry |
HA-001H7N8CL | Recombinant H7N8 HA cell lysate | +Inquiry |
CPBT-32008RH | Rabbit Anti-Human SERPINA6 Polyclonal Antibody | +Inquiry |
TNFRSF17-1489RCL | Recombinant Rat TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARVD9 Products
Required fields are marked with *
My Review for All ARVD9 Products
Required fields are marked with *
0
Inquiry Basket