Recombinant Full Length Human PKM Protein, C-Flag-tagged

Cat.No. : PKM-1018HFL
Product Overview : Recombinant Full Length Human PKM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 57.9 kDa
AA Sequence : MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMN VARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATL KITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVN LPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRF DEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN AVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEAS YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRV
NFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Glycolysis / Gluconeogenesis, Metabolic pathways, Purine metabolism, Pyruvate metabolism, Type II diabetes mellitus
Full Length : Full L.
Gene Name PKM pyruvate kinase M1/2 [ Homo sapiens (human) ]
Official Symbol PKM
Synonyms PK3; TCB; p58; OIP3; PKM2; CTHBP; THBP1; HEL-S-30
Gene ID 5315
mRNA Refseq NM_182471.4
Protein Refseq NP_872271.1
MIM 179050
UniProt ID P14618

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PKM Products

Required fields are marked with *

My Review for All PKM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon