Recombinant Full Length Human PIAS4 Protein, C-Flag-tagged
Cat.No. : | PIAS4-1442HFL |
Product Overview : | Recombinant Full Length Human PIAS4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables SUMO ligase activity and ubiquitin protein ligase binding activity. Involved in negative regulation of transcription, DNA-templated; positive regulation of protein sumoylation; and protein sumoylation. Located in cytoplasm and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.3 kDa |
AA Sequence : | MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKN SEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFN MLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPP NIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLT SSELLQRLKTIGVKHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDA VFYLQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEEEEEEEEEDED EEGPRPKRRCPFQKGLVPACTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | Jak-STAT signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | PIAS4 protein inhibitor of activated STAT 4 [ Homo sapiens (human) ] |
Official Symbol | PIAS4 |
Synonyms | PIASY; Piasg; ZMIZ6; PIAS-gamma |
Gene ID | 51588 |
mRNA Refseq | NM_015897.4 |
Protein Refseq | NP_056981.2 |
MIM | 605989 |
UniProt ID | Q8N2W9 |
◆ Recombinant Proteins | ||
Pias4-4850M | Recombinant Mouse Pias4 Protein, Myc/DDK-tagged | +Inquiry |
Pias4-1939M | Recombinant Mouse Pias4 Protein, His-tagged | +Inquiry |
PIAS4-1442HFL | Recombinant Full Length Human PIAS4 Protein, C-Flag-tagged | +Inquiry |
PIAS4-246H | Recombinant Human PIAS4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PIAS4-1674H | Recombinant Human PIAS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIAS4-3201HCL | Recombinant Human PIAS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIAS4 Products
Required fields are marked with *
My Review for All PIAS4 Products
Required fields are marked with *
0
Inquiry Basket