Recombinant Full Length Human PI4K2A Protein, C-Flag-tagged
Cat.No. : | PI4K2A-2031HFL |
Product Overview : | Recombinant Full Length Human PI4K2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo- and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.8 kDa |
AA Sequence : | MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAA QGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFV KDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPR TKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAE PLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLA FPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQI AVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PI4K2A phosphatidylinositol 4-kinase type 2 alpha [ Homo sapiens (human) ] |
Official Symbol | PI4K2A |
Synonyms | PI4KII; PIK42A |
Gene ID | 55361 |
mRNA Refseq | NM_018425.4 |
Protein Refseq | NP_060895.1 |
MIM | 609763 |
UniProt ID | Q9BTU6 |
◆ Recombinant Proteins | ||
PI4K2A-6714M | Recombinant Mouse PI4K2A Protein, His (Fc)-Avi-tagged | +Inquiry |
PI4K2A-4097R | Recombinant Rat PI4K2A Protein, His (Fc)-Avi-tagged | +Inquiry |
PI4K2A-2031HFL | Recombinant Full Length Human PI4K2A Protein, C-Flag-tagged | +Inquiry |
PI4K2A-159H | Active Recombinant Human PI4K2A protein, GST-tagged | +Inquiry |
PI4K2A-12538Z | Recombinant Zebrafish PI4K2A | +Inquiry |
◆ Cell & Tissue Lysates | ||
PI4K2A-1350HCL | Recombinant Human PI4K2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PI4K2A Products
Required fields are marked with *
My Review for All PI4K2A Products
Required fields are marked with *
0
Inquiry Basket