Recombinant Full Length Human PGAM5 Protein, C-Flag-tagged
Cat.No. : | PGAM5-1953HFL |
Product Overview : | Recombinant Full Length Human PGAM5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables GTPase activator activity and protein serine/threonine phosphatase activity. Involved in necroptotic process. Located in mitochondrion. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.5 kDa |
AA Sequence : | MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSL INVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGL KFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRN YIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGF MPPDKITRS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | PGAM5 PGAM family member 5, mitochondrial serine/threonine protein phosphatase [ Homo sapiens (human) ] |
Official Symbol | PGAM5 |
Synonyms | BXLBV68 |
Gene ID | 192111 |
mRNA Refseq | NM_001170543.2 |
Protein Refseq | NP_001164014 |
MIM | 614939 |
UniProt ID | Q96HS1 |
◆ Recombinant Proteins | ||
HK1-2818H | Recombinant Human HK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Car12-7847M | Recombinant Mouse Car12 protein, His-tagged | +Inquiry |
BCAT2-575HFL | Recombinant Full Length Human BCAT2 Protein, C-Flag-tagged | +Inquiry |
GALNS-0129H | Recombinant Human GALNS Protein (M1-H522), His tagged | +Inquiry |
SUI-0024P2-2448S | Recombinant Staphylococcus aureus (strain: 18809) SUI_0024P2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LN-2686M | Native Mouse LN Protein | +Inquiry |
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
VLDL-252H | Native Human Very Low Density Lipoprotein | +Inquiry |
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FRA10AC1-196HCL | Recombinant Human FRA10AC1 cell lysate | +Inquiry |
LEAP2-4781HCL | Recombinant Human LEAP2 293 Cell Lysate | +Inquiry |
LINGO1-4728HCL | Recombinant Human LINGO1 293 Cell Lysate | +Inquiry |
Sp2-0-Ag14-1677M | Sp2/0-Ag14 (mouse hybridoma) whole cell lysate | +Inquiry |
HRK-5391HCL | Recombinant Human HRK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGAM5 Products
Required fields are marked with *
My Review for All PGAM5 Products
Required fields are marked with *
0
Inquiry Basket