Recombinant Full Length Human PGAM2 Protein, C-Flag-tagged
Cat.No. : | PGAM2-1997HFL |
Product Overview : | Recombinant Full Length Human PGAM2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Phosphoglycerate mutase (PGAM) catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The PGAM is a dimeric enzyme containing, in different tissues, different proportions of a slow-migrating muscle (MM) isozyme, a fast-migrating brain (BB) isozyme, and a hybrid form (MB). This gene encodes muscle-specific PGAM subunit. Mutations in this gene cause muscle phosphoglycerate mutase eficiency, also known as glycogen storage disease X. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.6 kDa |
AA Sequence : | MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAI LDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKER RYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNL PTGIPIVYELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glycolysis / Gluconeogenesis, Metabolic pathways |
Full Length : | Full L. |
Gene Name | PGAM2 phosphoglycerate mutase 2 [ Homo sapiens (human) ] |
Official Symbol | PGAM2 |
Synonyms | GSD10, PGAM-M, PGAMM |
Gene ID | 5224 |
mRNA Refseq | NM_000290.4 |
Protein Refseq | NP_000281.2 |
MIM | 612931 |
UniProt ID | P15259 |
◆ Recombinant Proteins | ||
PGAM2-4400R | Recombinant Rat PGAM2 Protein | +Inquiry |
PGAM2-1163H | Recombinant Human PGAM2 | +Inquiry |
PGAM2-1997HFL | Recombinant Full Length Human PGAM2 Protein, C-Flag-tagged | +Inquiry |
Pgam2-4816M | Recombinant Mouse Pgam2 Protein, Myc/DDK-tagged | +Inquiry |
PGAM2-15H | Active Recombinant Human PGAM2 protein, His-tagged (Bioactivity Validated) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGAM2-3263HCL | Recombinant Human PGAM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGAM2 Products
Required fields are marked with *
My Review for All PGAM2 Products
Required fields are marked with *
0
Inquiry Basket