Recombinant Full Length Human PELI1 Protein, C-Flag-tagged
Cat.No. : | PELI1-1768HFL |
Product Overview : | Recombinant Full Length Human PELI1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables ubiquitin protein ligase activity. Involved in several processes, including negative regulation of necroptotic process; protein polyubiquitination; and response to lipopolysaccharide. Predicted to be located in cytosol. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAIS NKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACR IICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREIS VCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARP QCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCE AGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PELI1 pellino E3 ubiquitin protein ligase 1 [ Homo sapiens (human) ] |
Official Symbol | PELI1 |
Synonyms | DKFZp686C18116; MGC50990 |
Gene ID | 57162 |
mRNA Refseq | NM_020651.4 |
Protein Refseq | NP_065702.2 |
MIM | 614797 |
UniProt ID | Q96FA3 |
◆ Recombinant Proteins | ||
PELI1-659H | Recombinant Human PELI1 Protein, His&GST-tagged | +Inquiry |
PELI1-5917H | Recombinant Human PELI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PELI1-2090C | Recombinant Chicken PELI1 | +Inquiry |
PELI1-1255H | Recombinant Human PELI1 | +Inquiry |
PELI1-2335H | Recombinant Human PELI1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PELI1-3304HCL | Recombinant Human PELI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PELI1 Products
Required fields are marked with *
My Review for All PELI1 Products
Required fields are marked with *
0
Inquiry Basket