Recombinant Full Length Human PCCA Protein, C-Flag-tagged
Cat.No. : | PCCA-502HFL |
Product Overview : | Recombinant Full Length Human PCCA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA encodes the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 75 kDa |
AA Sequence : | MAGFWVGTAPLVAAGRRGRWPPQQLMLSAALRTLKHVLYYSRQCLMVSRNLGSVGYDPNEKTFDKILVAN RGEIACRVIRTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVH PGYGFLSENKEFARCLAAEDVVFIGPDTHAIQAMGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAR EIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHG NALWLNERECSIQRRNQKVVEEAPSIFLDAETRRAMGEQAVALARAVKYSSAGTVEFLVDSKKNFYFLEM NTRLQVEHPVTECITGLDLVQEMIRVAKGYPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQY QEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNYVIRGVTHNIALLREVII NSRFVKGDISTKFLSDVYPDGFKGHMLTKSEKNQLLAIASSLFVAFQLRAQHFQENSRMPVIKPDIANWE LSVKLHDKVHTVVASNNGSVFSVEVDGSKLNVTSTWNLASPLLSVSVDGTQRTVQCLSREAGGNMSIQFL GTVYKVNILTRLAAELNKFMLEKVTEDTSSVLRSPMPGVVVAVSVKPGDAVAEGQEICVIEAMKMQNSMT AGKTGTVKSVHCQAGDTVGEGDLLVELETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Propanoate metabolism, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | PCCA propionyl-CoA carboxylase subunit alpha [ Homo sapiens (human) ] |
Official Symbol | PCCA |
Synonyms | PCCase alpha subunit; propanoyl-CoA:carbon dioxide ligase alpha subunit; propionyl-CoA carboxylase alpha chain, mitochondrial; propionyl-coenzyme A carboxylase, alpha polypeptide; Propionyl Coenzyme A carboxylase alpha polypeptide |
Gene ID | 5095 |
mRNA Refseq | NM_000282.4 |
Protein Refseq | NP_000273.2 |
MIM | 232000 |
UniProt ID | P05165 |
◆ Recombinant Proteins | ||
PCCA-12H | Recombinant Human PCCA Protein, C-MYC/DDK-tagged | +Inquiry |
PCCA-1617H | Recombinant Human PCCA Protein, His (Fc)-Avi-tagged | +Inquiry |
PCCA-842Z | Recombinant Zebrafish PCCA | +Inquiry |
PCCA-4292R | Recombinant Rat PCCA Protein | +Inquiry |
PCCA-8176H | Recombinant Human PCCA protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCCA-3400HCL | Recombinant Human PCCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCCA Products
Required fields are marked with *
My Review for All PCCA Products
Required fields are marked with *
0
Inquiry Basket