Recombinant Full Length Human Palmitoyltransferase Zdhhc2(Zdhhc2) Protein, His-Tagged
Cat.No. : | RFL22062HF |
Product Overview : | Recombinant Full Length Human Palmitoyltransferase ZDHHC2(ZDHHC2) Protein (Q9UIJ5) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYH LLFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTR TMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSL LYCLFIAATDLQYFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNK STLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQ DPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPGKCKAGMSNPA LTMENET |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ZDHHC2 |
Synonyms | ZDHHC2; REAM; REC; ZNF372; Palmitoyltransferase ZDHHC2; Acyltransferase ZDHHC2; Reduced expression associated with metastasis protein; Ream; Reduced expression in cancer protein; Rec; Zinc finger DHHC domain-containing protein 2; DHHC-2; Zinc finger prote |
UniProt ID | Q9UIJ5 |
◆ Recombinant Proteins | ||
EFNB2-1403H | Active Recombinant Human EFNB2 protein, Fc-tagged | +Inquiry |
MERTK-149H | Recombinant Human MERTK protein, His-tagged | +Inquiry |
LSM7-9336M | Recombinant Mouse LSM7 Protein | +Inquiry |
INSIG1-2734R | Recombinant Rat INSIG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLGD-RS00565-5223S | Recombinant Staphylococcus lugdunensis HKU09-01 SLGD_RS00565 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
Calmodulin-016 | Native Calmodulin Protein | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK2A1-001MCL | Recombinant Mouse CSNK2A1 cell lysate | +Inquiry |
CENPO-7578HCL | Recombinant Human CENPO 293 Cell Lysate | +Inquiry |
DKKL1-1680HCL | Recombinant Human DKKL1 cell lysate | +Inquiry |
TUBB1-652HCL | Recombinant Human TUBB1 293 Cell Lysate | +Inquiry |
TOB1-875HCL | Recombinant Human TOB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZDHHC2 Products
Required fields are marked with *
My Review for All ZDHHC2 Products
Required fields are marked with *
0
Inquiry Basket