Recombinant Full Length Mouse Palmitoyltransferase Zdhhc2(Zdhhc2) Protein, His-Tagged
Cat.No. : | RFL573MF |
Product Overview : | Recombinant Full Length Mouse Palmitoyltransferase ZDHHC2(Zdhhc2) Protein (P59267) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MAPSGSGGVRRRCRRVLYWIPVVFISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHL LFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRT MSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL YCLFIAATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKS TLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPVFSSQGDGCSFPTCLVNQD PEQPSTPAGLNSTVKNPENHQFPAKPLRESQSHLLKDSQTWTESSANPGKGKAGMSNPAL TMENET |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Zdhhc2 |
Synonyms | Zdhhc2; Palmitoyltransferase ZDHHC2; Acyltransferase ZDHHC2; Zinc finger DHHC domain-containing protein 2; DHHC-2 |
UniProt ID | P59267 |
◆ Recombinant Proteins | ||
ZDHHC2-3413H | Recombinant Human ZDHHC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Zdhhc2-7071M | Recombinant Mouse Zdhhc2 Protein, Myc/DDK-tagged | +Inquiry |
ZDHHC2-18786M | Recombinant Mouse ZDHHC2 protein, His-tagged | +Inquiry |
RFL22062HF | Recombinant Full Length Human Palmitoyltransferase Zdhhc2(Zdhhc2) Protein, His-Tagged | +Inquiry |
RFL30526RF | Recombinant Full Length Rat Palmitoyltransferase Zdhhc2(Zdhhc2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC2-193HCL | Recombinant Human ZDHHC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Zdhhc2 Products
Required fields are marked with *
My Review for All Zdhhc2 Products
Required fields are marked with *
0
Inquiry Basket