Recombinant Full Length Human OTULIN Protein, GST-tagged

• Cat.No.: OTULIN-4460HF
• Product Overview: Human FAM105B full-length ORF ( AAH07706.3, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the peptidase C65 family of ubiquitin isopeptidases. Members of this family remove ubiquitin from proteins. The encoded enzyme specifically recognizes and removes M1(Met1)-linked, or linear, ubiquitin chains from protein substrates. Linear ubiquitin chains are known to regulate the NF-kappa B signaling pathway in the context of immunity and inflammation. Mutations in this gene cause a potentially fatal autoinflammatory syndrome in human patients. [provided by RefSeq, Sep 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 51.3 kDa
• Protein length: 214 amino acids
• AA Sequence: MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: OTULIN OTU deubiquitinase with linear linkage specificity [ Homo sapiens (human) ]
• Official Symbol: OTULIN
• Synonyms: OTULIN; OTU deubiquitinase with linear linkage specificity; OTU Deubiquitinase With Linear Linkage Specificity; OTU Domain-Containing Deubiquitinase With Linear Linkage Specificity; Family With Sequence Similarity 105, Member B; Deubiquitinating Enzyme Otulin; Ubiquitin Thioesterase Gumby; FAM105B; Ubiquitin Thioesterase Otulin; EC 3.4.19.12; Gumby; AIPDS; GUM; ubiquitin thioesterase otulin; OTU domain-containing deubiquitinase with linear linkage specificity; deubiquitinating enzyme otulin; family with sequence similarity 105, member B; ubiquitin thioesterase Gumby
• Gene ID: 90268
• mRNA Refseq: NM_138348
• Protein Refseq: NP_612357
• MIM: 615712
• UniProt ID: Q96BN8