Recombinant Full Length Human OPA3 Protein, C-Flag-tagged
Cat.No. : | OPA3-2101HFL |
Product Overview : | Recombinant Full Length Human OPA3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.8 kDa |
AA Sequence : | MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKP LNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQV QAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | OPA3 outer mitochondrial membrane lipid metabolism regulator OPA3 [ Homo sapiens (human) ] |
Official Symbol | OPA3 |
Synonyms | MGA3 |
Gene ID | 80207 |
mRNA Refseq | NM_025136.4 |
Protein Refseq | NP_079412.1 |
MIM | 606580 |
UniProt ID | Q9H6K4 |
◆ Recombinant Proteins | ||
OPA3-12163M | Recombinant Mouse OPA3 Protein | +Inquiry |
Opa3-8012R | Recombinant Rat Opa3 protein, His & T7-tagged | +Inquiry |
OPA3-2101HFL | Recombinant Full Length Human OPA3 Protein, C-Flag-tagged | +Inquiry |
OPA3-1460H | Recombinant Human OPA3, His-tagged | +Inquiry |
OPA3-6396M | Recombinant Mouse OPA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OPA3-3575HCL | Recombinant Human OPA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OPA3 Products
Required fields are marked with *
My Review for All OPA3 Products
Required fields are marked with *
0
Inquiry Basket