Recombinant Full Length Human Olfactory Receptor 52K2(Or52K2) Protein, His-Tagged
Cat.No. : | RFL24055HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 52K2(OR52K2) Protein (Q8NGK3) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MSASNITLTHPTAFLLVGIPGLEHLHIWISIPFCLAYTLALLGNCTLLLIIQADAALHEP MYLFLAMLAAIDLVLSSSALPKMLAIFWFRDREINFFACLAQMFFLHSFSIMESAVLLAM AFDRYVAICKPLHYTKVLTGSLITKIGMAAVARAVTLMTPLPFLLRCFHYCRGPVIAHCY CEHMAVVRLACGDTSFNNIYGIAVAMFIVVLDLLLVILSYIFILQAVLLLASQEARYKAF GTCVSHIGAILAFYTTVVISSVMHRVARHAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ IRESILGVFPRKDM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR52K2 |
Synonyms | OR52K2; Olfactory receptor 52K2; Olfactory receptor OR11-7 |
UniProt ID | Q8NGK3 |
◆ Native Proteins | ||
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
VCL tail-900T | Native Turkey VCL tail Protein | +Inquiry |
EDN2-8310H | Native Human EDN2 | +Inquiry |
Lectin-1743N | Active Native Narcissus Pseudonarcissus (Daffodil) Lectin Protein | +Inquiry |
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM50B-6370HCL | Recombinant Human FAM50B 293 Cell Lysate | +Inquiry |
KDR-1769HCL | Recombinant Human KDR cell lysate | +Inquiry |
PNCK-1384HCL | Recombinant Human PNCK cell lysate | +Inquiry |
PLEKHA8P1-484HCL | Recombinant Human PLEKHA8P1 lysate | +Inquiry |
REL-2424HCL | Recombinant Human REL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR52K2 Products
Required fields are marked with *
My Review for All OR52K2 Products
Required fields are marked with *
0
Inquiry Basket