Recombinant Full Length Human Olfactory Receptor 52E2(Or52E2) Protein, His-Tagged
Cat.No. : | RFL14782HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 52E2(OR52E2) Protein (Q8NGJ4) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-325) |
Form : | Lyophilized powder |
AA Sequence : | MFLPNDTQFHPSSFLLLGIPGLETLHIWIGFPFCAVYMIALIGNFTILLVIKTDSSLHQP MFYFLAMLATTDVGLSTATIPKMLGIFWINLRGIIFEACLTQMFFIHNFTLMESAVLVAM AYDSYVAICNPLQYSAILTNKVVSVIGLGVFVRALIFVIPSILLILRLPFCGNHVIPHTY CEHMGLAHLSCASIKINIIYGLCAICNLVFDITVIALSYVHILCAVFRLPTHEARLKSLS TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI YKCVKKILLQEQGMEKEEYLIHTRF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR52E2 |
Synonyms | OR52E2; Olfactory receptor 52E2 |
UniProt ID | Q8NGJ4 |
◆ Recombinant Proteins | ||
PDLIM2-1874H | Recombinant Human PDLIM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YWHAZ-2861H | Recombinant Human YWHAZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UNC5C-6108R | Recombinant Rat UNC5C Protein, His (Fc)-Avi-tagged | +Inquiry |
TNK1-3326H | Recombinant Human TNK1, His-tagged | +Inquiry |
IVa2-2412H | Recombinant HAdV-B IVa2 protein(Thr3-Lys448), His-tagged | +Inquiry |
◆ Native Proteins | ||
Complement C1r-45H | Native Human Complement C1r | +Inquiry |
Lectin-1717U | Native Ulex europaeus Lectin | +Inquiry |
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAZ-001HCL | Recombinant Human GNAZ cell lysate | +Inquiry |
PKD1L2-1362HCL | Recombinant Human PKD1L2 cell lysate | +Inquiry |
COQ6-192HCL | Recombinant Human COQ6 lysate | +Inquiry |
STARD10-1423HCL | Recombinant Human STARD10 293 Cell Lysate | +Inquiry |
RPF1-2236HCL | Recombinant Human RPF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR52E2 Products
Required fields are marked with *
My Review for All OR52E2 Products
Required fields are marked with *
0
Inquiry Basket