Recombinant Full Length Human Olfactory Receptor 52B6(Or52B6) Protein, His-Tagged
Cat.No. : | RFL3306HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 52B6(OR52B6) Protein (Q8NGF0) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MAQVRALHKIMALFSANSIGAMNNSDTRIAGCFLTGIPGLEQLHIWLSIPFCIMYITALE GNGILICVILSQAILHEPMYIFLSMLASADVLLSTTTMPKALANLWLGYSLISFDGCLTQ MFFIHFLFIHSAVLLAMAFDRYVAICSPLRYVTILTSKVIGKIVTAALSHSFIIMFPSIF LLEHLHYCQINIIAHTFCEHMGIAHLSCSDISINVWYGLAAALLSTGLDIMLITVSYIHI LQAVFRLLSQDARSKALSTCGSHICVILLFYVPALFSVFAYRFGGRSVPCYVHILLASLY VVIPPMLNPVIYGVRTKPILEGAKQMFSNLAKGSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR52B6 |
Synonyms | OR52B6; Olfactory receptor 52B6; Olfactory receptor OR11-47 |
UniProt ID | Q8NGF0 |
◆ Native Proteins | ||
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
Thromboplastin-079B | Native Bovine Thromboplastin Protein | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
FG-164B | Native Bovine fibrinogen degradation products | +Inquiry |
◆ Cell & Tissue Lysates | ||
AES-8991HCL | Recombinant Human AES 293 Cell Lysate | +Inquiry |
Fetal Parietal Lobe -155H | Human Fetal Parietal Lobe Lysate | +Inquiry |
COMT-7365HCL | Recombinant Human COMT 293 Cell Lysate | +Inquiry |
PPM1B-2962HCL | Recombinant Human PPM1B 293 Cell Lysate | +Inquiry |
ZBTB44-214HCL | Recombinant Human ZBTB44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR52B6 Products
Required fields are marked with *
My Review for All OR52B6 Products
Required fields are marked with *
0
Inquiry Basket