Recombinant Full Length Human Olfactory Receptor 51B5(Or51B5) Protein, His-Tagged
Cat.No. : | RFL29902HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 51B5(OR51B5) Protein (Q9H339) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MSSSGSSHPFLLTGFPGLEEAHHWISVFFLFMYISILFGNGTLLLLIKEDHNLHEPMYFF LAMLAATDLGLALTTMPTVLGVLWLDHREIGSAACFSQAYFIHSLSFLESGILLAMAYDR FIAICNPLRYTSVLTNTRVVKIGLGVLMRGFVSVVPPIRPLYFFLYCHSHVLSHAFCLHQ DVIKLACADTTFNRLYPAVLVVFIFVLDYLIIFISYVLILKTVLSIASREERAKALITCV SHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLIMSYAYFLFPPLMNPITYSVKTKQIQNA ILHLFTTHRIGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR51B5 |
Synonyms | OR51B5; Olfactory receptor 51B5; Odorant receptor HOR5'beta5; Olfactory receptor OR11-37 |
UniProt ID | Q9H339 |
◆ Native Proteins | ||
ACOD-35 | Active Native acyl-CoA oxidase | +Inquiry |
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
Thrombin-29B | Active Native Bovine alpha-Thrombin-FPRck | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB3-460HCL | Recombinant Human SERPINB3 cell lysate | +Inquiry |
NME1-3792HCL | Recombinant Human NME1 293 Cell Lysate | +Inquiry |
RNF25-1526HCL | Recombinant Human RNF25 cell lysate | +Inquiry |
IL1R1-1935RCL | Recombinant Rat IL1R1 cell lysate | +Inquiry |
AUP1-54HCL | Recombinant Human AUP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR51B5 Products
Required fields are marked with *
My Review for All OR51B5 Products
Required fields are marked with *
0
Inquiry Basket