Recombinant Full Length Meyerozyma Guilliermondii Altered Inheritance Of Mitochondria Protein 11(Aim11) Protein, His-Tagged
Cat.No. : | RFL5766MF |
Product Overview : | Recombinant Full Length Meyerozyma guilliermondii Altered inheritance of mitochondria protein 11(AIM11) Protein (A5DJS9) (1-155aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Meyerozyma guilliermondii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-155) |
Form : | Lyophilized powder |
AA Sequence : | MSFTNLLEKYDFKLASASEEYKQRRKYQMALFMASGAATIFAARFAFKSTMARQYVPTLF QGNHQPPTSYNFTTDAAVAVGTGTVLCGSVSSMIIFGTCWMMDVSTFKEFGWRMKTVMGG YEKQKQLAQMPLDEESEIIQNGLNDILEGKYDDIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AIM11 |
Synonyms | AIM11; PGUG_03530; Altered inheritance of mitochondria protein 11 |
UniProt ID | A5DJS9 |
◆ Recombinant Proteins | ||
KLK6-1040H | Recombinant Human KLK6 protein(Met1-Lys244) | +Inquiry |
MYL2-3513R | Recombinant Rat MYL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPF31-10798Z | Recombinant Zebrafish PRPF31 | +Inquiry |
LHB-1511H | Recombinant Human LHB Protein, MYC/DDK-tagged | +Inquiry |
SNCA-3509H | Recombinant Human SNCA protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Chitin-001C | Native Crawfish Chitin | +Inquiry |
TF-324H | Native Human Transferrin, Texas Red Label | +Inquiry |
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
AC-63B | Native Bovine Activated Protein C | +Inquiry |
SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM171-989HCL | Recombinant Human TMEM171 293 Cell Lysate | +Inquiry |
TRIM61-764HCL | Recombinant Human TRIM61 293 Cell Lysate | +Inquiry |
SLC30A6-605HCL | Recombinant Human SLC30A6 lysate | +Inquiry |
SLC20A2-1620HCL | Recombinant Human SLC20A2 cell lysate | +Inquiry |
EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All AIM11 Products
Required fields are marked with *
My Review for All AIM11 Products
Required fields are marked with *
0
Inquiry Basket