Recombinant Full Length Human Olfactory Receptor 51B4(Or51B4) Protein, His-Tagged
Cat.No. : | RFL17005HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 51B4(OR51B4) Protein (Q9Y5P0) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSVLFGNGTLLVLIWNDHSLHEPMYYF LAMLADTDLGMTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCF IAIRTPLRYNCILTNSRVMNIGLGVLMRGFMSILPIILSLYCYPYCGSRALLHTFCLHQD VIKLACADITFNHIYPIIQTSLTVFLDALIIIFSYILILKTVMGIASGQEEAKSLNTCVS HISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLFPPFVNPIIYSIKTKQIQRSI IRLFSGQSRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR51B4 |
Synonyms | OR51B4; Olfactory receptor 51B4; Odorant receptor HOR5'beta1 |
UniProt ID | Q9Y5P0 |
◆ Recombinant Proteins | ||
CCL1-214H | Recombinant Human CCL1 Protein, DYKDDDDK-tagged | +Inquiry |
ZNF287-5318R | Recombinant Rhesus monkey ZNF287 Protein, His-tagged | +Inquiry |
TIAL1-4188H | Recombinant Human TIAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27885MF | Recombinant Full Length Mouse Killer Cell Lectin-Like Receptor Subfamily G Member 2(Klrg2) Protein, His-Tagged | +Inquiry |
ATP5A1-5859C | Recombinant Chicken ATP5A1 | +Inquiry |
◆ Native Proteins | ||
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
Complement C3c-49H | Native Human Complement C3c | +Inquiry |
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RORC-2245HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
ZNF558-52HCL | Recombinant Human ZNF558 293 Cell Lysate | +Inquiry |
CFD-1870MCL | Recombinant Mouse CFD cell lysate | +Inquiry |
ONECUT1-3576HCL | Recombinant Human ONECUT1 293 Cell Lysate | +Inquiry |
CNN3-7404HCL | Recombinant Human CNN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR51B4 Products
Required fields are marked with *
My Review for All OR51B4 Products
Required fields are marked with *
0
Inquiry Basket