Recombinant Full Length Human Olfactory Receptor 11H7(Or11H7) Protein, His-Tagged
Cat.No. : | RFL31583HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 11H7(OR11H7) Protein (Q8NGC8) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MNNSQISTVTQFVLLGFPGPWKIQIIFFSMILLVYIFTLTGNMAIICAVRWDHRLHTPMY VLLANFSFLEIWYVTCTVPNMLVNFFSKTKTISFSGCFTQFHFFFSLGTTECFFLCVMAY DRYLAICHPLHYPSIMTGQLCGILVSLCWLIGFLGHSISIFFIFQLPFCGPNIIDHFLCD VDPLMALSSAPTHIIGHVFHSVSSLFINLTMVYILGSYTLVLRTVLQVPSSAGWQKAIST CGSHLVVVSLFYGAIMLMYVSPTPGNSVAMHKLITLIYSVVTPVLNPLIYSLRNKDMKYA LHHVFCGMRIIQRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR11H7 |
Synonyms | OR11H7; OR11H7P; Olfactory receptor 11H7; Olfactory receptor OR14-32 |
UniProt ID | Q8NGC8 |
◆ Recombinant Proteins | ||
INPP5B-5106H | Recombinant Human INPP5B Protein, GST-tagged | +Inquiry |
Pros1-5053R | Recombinant Rat Pros1 protein, His-tagged | +Inquiry |
SLC2A1A-3652Z | Recombinant Zebrafish SLC2A1A | +Inquiry |
PNMT-30072TH | Recombinant Human PNMT | +Inquiry |
YCZK-3521B | Recombinant Bacillus subtilis YCZK protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
HBb-49S | Native Sheep Hemoglobin Beta (HBb) Protein | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB20-2621HCL | Recombinant Human RAB20 293 Cell Lysate | +Inquiry |
TRIM60-1831HCL | Recombinant Human TRIM60 cell lysate | +Inquiry |
SEPT5-1957HCL | Recombinant Human SEPT5 293 Cell Lysate | +Inquiry |
OR8A1-3555HCL | Recombinant Human OR8A1 293 Cell Lysate | +Inquiry |
SFTPD-2675MCL | Recombinant Mouse SFTPD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR11H7 Products
Required fields are marked with *
My Review for All OR11H7 Products
Required fields are marked with *
0
Inquiry Basket