Recombinant Full Length Human Olfactory Receptor 10J4(Or10J4) Protein, His-Tagged
Cat.No. : | RFL14789HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 10J4(OR10J4) Protein (P0C629) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MPRPNFMAVTEFTFEGFSIFEWHHRLILFVIFLVLYVLTLASNAIILIVIRLNHQLHTPM YFFLSVLSISETYYTVAINPQMLSGLLSPQQTISIPGCAAQLFFYLTFGVNKCFLLTAMG YDHYVAICNPLQYSVIMGKKACIQLVSGSWNIGLSTAIIQVSSVFSLPFCDANLISHFFC DIRPIMKLACADTTIKEIITLLISLCVLVLPMVLIFISYVLIVTTILKIASAEGRRKAFA TCASHLTVVIVHYGRTSFIYLKPKSQNSLQDRLISVTYTVITPLLNPVVYSLRNKEVKDA LLRALGRKPLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR10J4 |
Synonyms | OR10J4; OR10J4P; Olfactory receptor 10J4 |
UniProt ID | P0C629 |
◆ Recombinant Proteins | ||
RBP4-31234TH | Recombinant Human RBP4 | +Inquiry |
PCSK1N-1621H | Recombinant Human PCSK1N Protein, His (Fc)-Avi-tagged | +Inquiry |
FLT3-1454H | Active Recombinant Human FLT3 protein, Fc-tagged, FITC-Labeled | +Inquiry |
STX1B-5812R | Recombinant Rat STX1B Protein | +Inquiry |
Ctsb-10530M | Recombinant Mouse Ctsb Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-219H | Native Human Immunoglobulin G | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
IgY-005C | Native Chicken IgY Ig Fraction | +Inquiry |
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A10-1785HCL | Recombinant Human SLC25A10 293 Cell Lysate | +Inquiry |
ATXN7L1-151HCL | Recombinant Human ATXN7L1 cell lysate | +Inquiry |
FGF9-2955HCL | Recombinant Human FGF9 cell lysate | +Inquiry |
C10orf54-8365HCL | Recombinant Human C10orf54 293 Cell Lysate | +Inquiry |
NDUFB2-3907HCL | Recombinant Human NDUFB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR10J4 Products
Required fields are marked with *
My Review for All OR10J4 Products
Required fields are marked with *
0
Inquiry Basket