Recombinant Full Length Human NR1I2 Protein, GST-tagged

• Cat.No.: NR1I2-6702HF
• Product Overview: Human NR1I2 full-length ORF ( NP_003880.3, 1 a.a. - 434 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 76.2 kDa
• Protein length: 434 amino acids
• AA Sequence: MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NR1I2 nuclear receptor subfamily 1, group I, member 2 [ Homo sapiens ]
• Official Symbol: NR1I2
• Synonyms: NR1I2; nuclear receptor subfamily 1, group I, member 2; nuclear receptor subfamily 1 group I member 2; BXR; ONR1; PAR2; PXR; SXR; pregnane X receptor; orphan nuclear receptor PXR; orphan nuclear receptor PAR1; steroid and xenobiotic receptor; pregnane X nuclear receptor variant 2; PAR; PRR; SAR; PAR1; PARq
• Gene ID: 8856
• mRNA Refseq: NM_003889
• Protein Refseq: NP_003880
• MIM: 603065
• UniProt ID: O75469