Recombinant Full Length Human NPHS2 Protein, C-Flag-tagged
Cat.No. : | NPHS2-1841HFL |
Product Overview : | Recombinant Full Length Human NPHS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that plays a role in the regulation of glomerular permeability. Mutations in this gene cause steroid-resistant nephrotic syndrome. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42 kDa |
AA Sequence : | MERRARSSSRESRGRGGRTPHKENKRAKAERSGGGRGRQEAGPEPSGSGRAGTPGEPRAPAATVVDVDEV RGSGEEGTEVVALLESERPEEGTKSSGLGACEWLLVLISLLFIIMTFPFSIWFCVKVVQEYERVIIFRLG HLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASLLLSSLAHV SKAVQFLVQTTMKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAV EAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCL SSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | NPHS2 NPHS2 stomatin family member, podocin [ Homo sapiens (human) ] |
Official Symbol | NPHS2 |
Synonyms | PDCN; SRN1 |
Gene ID | 7827 |
mRNA Refseq | NM_014625.4 |
Protein Refseq | NP_055440.1 |
MIM | 604766 |
UniProt ID | Q9NP85 |
◆ Recombinant Proteins | ||
NPHS2-1272H | Recombinant Human NPHS2 protein, His-tagged | +Inquiry |
Nphs2-5644R | Recombinant Rat Nphs2 protein, His-tagged | +Inquiry |
NPHS2-4043R | Recombinant Rat NPHS2 Protein | +Inquiry |
NPHS2-6624HF | Recombinant Full Length Human NPHS2 Protein, GST-tagged | +Inquiry |
NPHS2-717H | Recombinant Human NPHS2 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPHS2-1211HCL | Recombinant Human NPHS2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPHS2 Products
Required fields are marked with *
My Review for All NPHS2 Products
Required fields are marked with *
0
Inquiry Basket