Recombinant Full Length Human NMT1 Protein, C-Flag-tagged
Cat.No. : | NMT1-1355HFL |
Product Overview : | Recombinant Full Length Human NMT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase (NMT; EC 2.3.1.97) catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.6 kDa |
AA Sequence : | MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSE TDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEP DKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQW HCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAV YTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVH QLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEK VGLVLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | NMT1 N-myristoyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | NMT1 |
Synonyms | NMT; HsNMT1 |
Gene ID | 4836 |
mRNA Refseq | NM_021079.5 |
Protein Refseq | NP_066565.1 |
MIM | 160993 |
UniProt ID | P30419 |
◆ Recombinant Proteins | ||
NMT1-1355HFL | Recombinant Full Length Human NMT1 Protein, C-Flag-tagged | +Inquiry |
Nmt1-4447M | Recombinant Mouse Nmt1 Protein, Myc/DDK-tagged | +Inquiry |
NMT1-6602HF | Recombinant Full Length Human NMT1 Protein, GST-tagged | +Inquiry |
NMT1-10754M | Recombinant Mouse NMT1 Protein | +Inquiry |
NMT1-1521H | Recombinant Human NMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMT1-3783HCL | Recombinant Human NMT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMT1 Products
Required fields are marked with *
My Review for All NMT1 Products
Required fields are marked with *
0
Inquiry Basket